PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G058200.1.p
Common NameSETIT_023710mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 111aa    MW: 12812.3 Da    PI: 9.1065
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G058200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.9e-104487447
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        WT eE+ +++++ + +G g+Wk I+r + + +t+ q+ s+ qky
  Seita.3G058200.1.p 44 WTIEEHRQFLHGLRWYGLGNWKNISRDFITIKTPVQVSSHAQKY 87
                        *****************************889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1373692IPR017930Myb domain
SuperFamilySSF466892.58E-144093IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-84287IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-134290IPR006447Myb domain, plants
CDDcd001675.80E-74488No hitNo description
PfamPF002499.0E-74487IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MYSTQQPIDP KLNGEWSASE MVQEAPHSQV IIPQQERHHN GRFWTIEEHR QFLHGLRWYG  60
LGNWKNISRD FITIKTPVQV SSHAQKYFCR LERTSSSYGS NSQIQGNLVG *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963442.14e-36PREDICTED: uncharacterized protein LOC101780786
SwissprotQ8S9H72e-17DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3ZAY91e-78K3ZAY9_SETIT; Uncharacterized protein
STRINGSi023710m3e-78(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.19e-20MYB family protein